PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna00431.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 696aa    MW: 75754.7 Da    PI: 5.0833
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna00431.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47e-18172219148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WTt Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  mrna00431.1-v1.0-hybrid 172 KGPWTTAEDAILVEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 219
                              79******************************************9986 PP

2Myb_DNA-binding538e-17225268146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g++T+eE+ l+v++++++G++ W++ a++++ gRt++++k++w++
  mrna00431.1-v1.0-hybrid 225 KGAFTPEEERLIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 268
                              799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.678167219IPR017930Myb domain
SMARTSM007171.3E-15171221IPR001005SANT/Myb domain
SuperFamilySSF466892.43E-30171266IPR009057Homeodomain-like
PfamPF002491.1E-15172219IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-24173226IPR009057Homeodomain-like
CDDcd001677.06E-12174219No hitNo description
PROSITE profilePS5129426.711220274IPR017930Myb domain
SMARTSM007173.4E-17224272IPR001005SANT/Myb domain
PfamPF002491.1E-15225268IPR001005SANT/Myb domain
CDDcd001671.97E-12227268No hitNo description
Gene3DG3DSA:1.10.10.606.2E-26227273IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MLSLENITSD TKFHLITNRL RPFDETRNSP PHPDRHGTLS APTRTNAAAL RCVAPSTLAS  60
SPSSSTNSGV PLIRFSQLSD QFDTTLETIL ICDSRFPVLE IIDCEKGPIF WVFDSVKGQC  120
RVSACITSGS KEEMSRTTSD SEDGMFSKDQ IESPLMDENN GGIGNGGIIL KKGPWTTAED  180
AILVEYVKKH GEGNWNAVQK HSGLFRCGKS CRLRWANHLR PNLKKGAFTP EEERLIVELH  240
AKMGNKWARM AAHLPGRTDN EIKNYWNTRI KRRQRAGLPL YPPELSLQAS QESQQGHSGG  300
ALNGTDRAHH DSLQSNSYEI PDVVFDSLKG NNCVLPYVPE LPDISASGML MKGLGSSPYC  360
GFMPPTMHRQ KRPRESTALF PTSGSSFRDG FPQFDQYEND ACDKVARPFG LPFLPDPDPT  420
TKSPLSFGVI QGCHSLSNGN SSACRPTYGP VKLELPSLQY PETDLGSWST SPPPPLLESF  480
DNFIQSPPPV GAFESDCASP RNSGLLDALL YESKTLSSTK NHSTDKSSIS SSVTPGEVAD  540
SSTLNVCETE WEEYGDPISP LGHSATLLFS ECTPISASGS SLEEAPPAET ITGSNVKPEP  600
ADHAWTPEKQ KESSPPLDYI RPDALLGSDW LEPSTGIKDQ SIMNMNDAIV SLLGEDLVTE  660
YKHMASGTST SNQGWGLGSC PWNNMPAVCQ MTDLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-321702735107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011468770.10.0PREDICTED: transcription factor GAMYB
TrEMBLM5X3T10.0M5X3T1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-133myb domain protein 33